PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015880809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB_related
Protein Properties Length: 406aa    MW: 46818.6 Da    PI: 9.8082
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015880809.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-122262445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     W ++E  ll+++++++G ++W+ +a+++g +++  qc+++++
   XP_015880809.1 22 WNADEGSLLLEGIEMYGFRNWSEVAEHVG-TKSKAQCINHYN 62
                     *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-121664IPR009057Homeodomain-like
PROSITE profilePS5129318.0731769IPR017884SANT domain
SMARTSM007171.7E-91867IPR001005SANT/Myb domain
PfamPF002491.1E-112162IPR001005SANT/Myb domain
CDDcd001671.71E-102262No hitNo description
Gene3DG3DSA:1.10.10.604.6E-92264IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MSPFCRNINL DNLAYPLICP DWNADEGSLL LEGIEMYGFR NWSEVAEHVG TKSKAQCINH  60
YNATICMNSP FFPLLDLSHV MKKSREELLA MAKELKEDTM KQAFNKFQCL GRLQWKRSPP  120
FSARVKYDES RKGPIPQSSA LLTSGTETNI LETMFPHGDF CLYILYVSCT TDKACILLKS  180
KVVTGSVLGA VKKTSNKIQI NDEANAEELQ VKLRWTGVLE RKARLSGEKP FMMELSGYNS  240
KRQEFKIEYD NDAEQLLADM EFKDSDTNTE RELKLQVLHI YSKRLFKYLM RGNTGKTSYR  300
KEICFILTLL RKISHQKRRI CNCRLGFHAV SICQKDTRSS AKILCHSPKY KFASKLELLV  360
AEQFMRQIGS LNRRGRGKPE KMHLELRRVL RLVLVVKVQK ALSCQW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015880809.10.0PREDICTED: transcriptional adapter ADA2-like
TrEMBLW9RN144e-86W9RN14_9R
STRINGGLYMA13G11200.24e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726